DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Np

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster


Alignment Length:242 Identity:98/242 - (40%)
Similarity:141/242 - (58%) Gaps:13/242 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RIVGGQQVRSNKYPWTAQLVKGRHYPRLF-CGGSLINDRYVLTAAHCVHG-NRDQITIRLLQIDR 137
            |||||......::||...|.:.|....|. ||.:|:|:.:.:||||||.. ....:.:||.:.|.
  Fly   797 RIVGGANAAFGRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVPPSDLLLRLGEYDL 861

  Fly   138 SSRDP--GIVRKVVQTTV-HPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAV 199
            :..:.  |...:.||... ||.:||.....|:|||:...||....|:.|||:|:.:.||.|:||.
  Fly   862 AEEEEPYGYQERRVQIVASHPQFDPRTFEYDLALLRFYEPVIFQPNIIPVCVPDNDENFIGQTAF 926

  Fly   200 VAGWGLIKEGGVTSNYLQEVNVPVITNAQC----RQTRYKDKIAEVMLCAGLVQQGGKDACQGDS 260
            |.|||.:.|.|...:.||||.||||.|..|    |...|.:.|..:.:|||. ::||.|:|:|||
  Fly   927 VTGWGRLYEDGPLPSVLQEVAVPVINNTICESMYRSAGYIEHIPHIFICAGW-KKGGYDSCEGDS 990

  Fly   261 GGPLIV---NEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRK 304
            |||:::   ::.|:.|.||:|:|.|||:.|.||||.|:|:|.|||.:
  Fly   991 GGPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWINQ 1037

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 96/238 (40%)
Tryp_SPc 76..305 CDD:238113 97/241 (40%)
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 96/238 (40%)
Tryp_SPc 798..1038 CDD:238113 97/241 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.810

Return to query results.
Submit another query.