DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and flz

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:257 Identity:106/257 - (41%)
Similarity:142/257 - (55%) Gaps:22/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGT-PNV--NRIVGGQQVRSNKYPWTAQLVKGRHYPRLF----CGGSLINDRYVLTAAHCVHGNR 125
            ||. |:|  .|||||:......|||.. ||:...:..||    |||.||..|||:|||||..|..
  Fly  1438 CGVRPHVKSGRIVGGKGSTFGAYPWQV-LVRESTWLGLFTKNKCGGVLITSRYVITAAHCQPGFL 1501

  Fly   126 DQITIRLLQID-----RSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVC 185
            ..:...:.:.|     .|.|  .:.:.|.:..||..|||....||:|||:|:|||....::.|:|
  Fly  1502 ASLVAVMGEFDISGDLESKR--SVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPIC 1564

  Fly   186 LPEANHNFDGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQ----TRYKDKIAEVMLCAG 246
            :|....:|.|:.|.|.|||.:|.||...:.||||.||:|.|:.|::    ..:..||....||||
  Fly  1565 MPNDVADFTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAG 1629

  Fly   247 LVQQGGKDACQGDSGGPLIVN--EGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNT 306
            .. .|.||:|:|||||||::.  :|||:|||.||.|..||....||||.|.:.:..|:|..|
  Fly  1630 YA-NGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWLRSIT 1690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 99/241 (41%)
Tryp_SPc 76..305 CDD:238113 100/243 (41%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 100/243 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457808
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.