DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG8738

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:299 Identity:86/299 - (28%)
Similarity:138/299 - (46%) Gaps:45/299 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VVDVVDPAEQSIKAVRPPKSRNQCTAKQNCF--CGTPNVNRIV-------GGQQVRSNKYPWTAQ 92
            ||:...|....|:..|.|..||   .|....  ||..|...:.       .|:.|.: ::||...
  Fly   158 VVEECCPLGDQIEEGRNPIQRN---VKDFLLKGCGYSNPKGLYYQLDGYNNGESVFA-EFPWMVA 218

  Fly    93 L--VKGRHYPRLFCGGSLINDRYVLTAAHCV-HGNRDQITIRLLQIDRSSR---DPGIVRKVVQT 151
            |  ::|    ...|||:||:.:.|||:||.| :.:.|.:.:|....|.:|:   .|..:|.:.:.
  Fly   219 LMDMEG----NFVCGGTLIHPQLVLTSAHNVFNRSEDSLLVRAGDWDLNSQTELHPYQMRAISEL 279

  Fly   152 TVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCL-----PEANHNFDGKTAVVAGWGL-IKEGG 210
            ..|.|::...:.||:||:.||.|..:..:::|:||     |:........:.:..|||| .....
  Fly   280 HRHENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWGLRYSTSR 344

  Fly   211 VTSNYLQEVNVPVITNAQCRQ--------TRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIV- 266
            ...|.|:.:.:|.:.:..|::        .||  .:.....|||.|:  |||.|.||.|.||.. 
  Fly   345 TMENLLKRIELPAVDHESCQRLLRHTVLGRRY--NLHPSFTCAGGVK--GKDTCMGDGGSPLFCT 405

  Fly   267 ---NEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302
               .:.||:|.|:||:|..||:|:.|..|..|:...:||
  Fly   406 LPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 72/257 (28%)
Tryp_SPc 76..305 CDD:238113 74/258 (29%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 73/247 (30%)
Tryp_SPc 207..444 CDD:214473 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.