DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG18478

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:270 Identity:79/270 - (29%)
Similarity:133/270 - (49%) Gaps:35/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 CFCGTPNVNRI---VGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRD- 126
            |..|.|:..::   |...|.:..::|||..::   |...|..|||||....||||||.:. |:| 
  Fly    31 CGYGNPDAVKVQFNVTEGQAKPAEFPWTIAVI---HNRSLVGGGSLITPDIVLTAAHRIF-NKDV 91

  Fly   127 -QITIRLLQ------IDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPV 184
             .|.:...:      :::...:...|.|:|   :|.:::..|..|::|||.|:...|||..:..:
  Fly    92 EDIVVSAGEWEYGSALEKYPFEEAFVLKMV---IHKSFNYQRGANNLALLFLDREFPLTYKINTI 153

  Fly   185 CLPEANHNFDGKTAVVAGWGLIK-----EGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAE-VML 243
            |||....:......:|||||..:     .|||    |:::::|::....|:....|.::.: ..|
  Fly   154 CLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGV----LKKIDLPIVPRHICQDQLRKTRLGQNYTL 214

  Fly   244 CAGLVQQGGK---DACQGDSGG----PLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDW 301
            ..||:..||:   |||.||.||    |:..:..:::..|:|::|.||.:||.|..|..|.:|..|
  Fly   215 PRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVPATYTDVFEFKPW 279

  Fly   302 IRKNTADGCY 311
            |.:...:..|
  Fly   280 IVQQIKENLY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 73/250 (29%)
Tryp_SPc 76..305 CDD:238113 75/252 (30%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 73/243 (30%)
Tryp_SPc 50..280 CDD:214473 71/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.