DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:258 Identity:102/258 - (39%)
Similarity:149/258 - (57%) Gaps:27/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CG-----TPNVNRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCV----HG 123
            ||     ||:..|||||.....:::||.|.|.|.   .:.|||||||.:.::|||||||    ..
  Fly   387 CGNKNPVTPDQERIVGGINASPHEFPWIAVLFKS---GKQFCGGSLITNSHILTAAHCVARMTSW 448

  Fly   124 NRDQITIRL--LQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCL 186
            :...:|..|  ..|........:.|::.:...|..::.:.:.||||:|.|..|||.|..::|:||
  Fly   449 DVAALTAHLGDYNIGTDFEVQHVSRRIKRLVRHKGFEFSTLHNDVAILTLSEPVPFTREIQPICL 513

  Fly   187 P----EANHNFDGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRY----KDKIAEVML 243
            |    :.:.::.|:.|.|||||.::|.|...:.||:|::|:.|||:|.: :|    ...|.|.|:
  Fly   514 PTSPSQQSRSYSGQVATVAGWGSLRENGPQPSILQKVDIPIWTNAECAR-KYGRAAPGGIIESMI 577

  Fly   244 CAGLVQQGGKDACQGDSGGPLIVNE-GRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKN 305
            |||   |..||:|.||||||:::|: |||...|:||:|.||.:...||||.||:..|.||.||
  Fly   578 CAG---QAAKDSCSGDSGGPMVINDGGRYTQVGIVSWGIGCGKGQYPGVYTRVTSLLPWIYKN 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 94/241 (39%)
Tryp_SPc 76..305 CDD:238113 95/243 (39%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 94/241 (39%)
Tryp_SPc 400..637 CDD:238113 95/243 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
54.910

Return to query results.
Submit another query.