DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG5390

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:262 Identity:92/262 - (35%)
Similarity:131/262 - (50%) Gaps:33/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGTPNVN----RIVG--GQQVRSNKYPWTAQLVKGRHYPRLF-CGGSLINDRYVLTAAHCVHGNR 125
            ||..|.|    :|.|  .|:....::||...:::......|: |||:||....|||||||||..:
  Fly   135 CGYQNPNGVGFKITGAVNQEAEFGEFPWMLAILREEGNLNLYECGGALIAPNVVLTAAHCVHNKQ 199

  Fly   126 -DQITIRLLQID-------RSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMR 182
             ..|.:|..:.|       |...|    |.|.:...|..::...:.||||::.||||..|..|::
  Fly   200 PSSIVVRAGEWDTQTQTEIRRHED----RYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQ 260

  Fly   183 PVCLPEANHNFDGKTAVVAGWGLIKEG--GVTSNYLQEVNVPVITNAQC----RQTRYKDK--IA 239
            .||||.....||.......|||..|.|  |.....|::|::||:...||    |:||....  :.
  Fly   261 TVCLPNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILH 325

  Fly   240 EVMLCAGLVQQGGKDACQGDSGGPLIV----NEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLD 300
            :..:|||  .:..||.|:||.|.||:.    .:.|:|.||:|::|.||.:.|.|||||.|:|...
  Fly   326 DSFICAG--GEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRP 388

  Fly   301 WI 302
            ||
  Fly   389 WI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 86/249 (35%)
Tryp_SPc 76..305 CDD:238113 88/250 (35%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 86/244 (35%)
Tryp_SPc 153..390 CDD:214473 84/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457458
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.