DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG18557

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:295 Identity:79/295 - (26%)
Similarity:139/295 - (47%) Gaps:61/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KSRNQCTAKQNCF------CGTPNVNRIVGG------QQVRSNKYPWTAQLVKGRHYPRLFCGGS 107
            :|.:.|.:.|...      ||..|.|.: ||      .|.:.|::|||..|:  ::....|..|:
  Fly    52 RSESCCHSSQKLVIGAPLNCGKSNPNGL-GGTVEEVVDQAKPNEFPWTVALM--QNLINFFGAGT 113

  Fly   108 LINDRYVLTAAHCVHGNRDQITIRLLQIDRSSRDPGIV----------------RKVVQTTVHPN 156
            |:.:..|:||||             |.:|::..|.||:                |...:...||:
  Fly   114 LVTENIVITAAH-------------LMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPD 165

  Fly   157 YDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAVVAGWGLIKEGGVTSNY---LQE 218
            ::.....|::||:.||:...:...:.|:|.|.:..:||.:..:|||||  :...:..||   .::
  Fly   166 FNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCLVAGWG--RPDFLAKNYSYKQKK 228

  Fly   219 VNVPVITNAQC----RQTRYKD--KIAEVMLCAGLVQQGGKDACQGDSGGPLIV----NEGRYKL 273
            :::|:::.:.|    |:|.:..  ::...:||||  .:.|:|||.||.|.||:.    :...|:|
  Fly   229 IDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAG--GERGRDACIGDGGSPLMCPIPGHPAIYEL 291

  Fly   274 AGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNTAD 308
            .|:|:.|:.|..:|.|.:|..:|....||.|...|
  Fly   292 VGIVNSGFSCGLENVPALYTNISHMRPWIEKQLND 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 68/261 (26%)
Tryp_SPc 76..305 CDD:238113 70/263 (27%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 68/253 (27%)
Tryp_SPc 90..320 CDD:214473 65/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.