DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG4259

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:247 Identity:67/247 - (27%)
Similarity:110/247 - (44%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VNRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCG-GSLINDRYVLTAAHCVHG-NRDQITIRLLQI 135
            :.|...|...|:. :||...::..|.:...:.| |||||...||||||.::| .:..:.:|..:.
  Fly    26 IRRETYGSNPRAT-FPWVVSVLDQRDWLFRYIGVGSLINPNVVLTAAHILNGTTKYDLVVRAGEW 89

  Fly   136 DRSSR--DPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMR--PVCLPEANHNFDGK 196
            |.|:.  ...:..:|:....|..::.....|::|||.|.|...:|.|:.  |:.|.||  .....
  Fly    90 DTSTTADQQHVDLEVLNIVSHEQFNRFNAENNMALLILVSAFEMTANINLIPLYLQEA--GIQKG 152

  Fly   197 TAVVAGWGLIKEGGVTSNY---LQEVNVPVITNAQCRQTRYKDKIAEVMLCA-GLVQQGGKDACQ 257
            :....|||.:...  :::|   |:.|.|.:::...|...    |:....:|. ||   .|.| |.
  Fly   153 SCFFNGWGKVYLN--STDYPTVLKTVQVDLLSMGMCSSR----KLPIQQICGKGL---EGID-CS 207

  Fly   258 GDSGGPLIVN----EGRYKLAGVVSFGYGCAQK---NAPGVYARVSKFLDWI 302
            ||.|.||:..    ..:|...|:|::   .:||   |...|:..|:..|.||
  Fly   208 GDGGAPLVCRILTYPYKYAQVGIVNW---LSQKPVENTFIVFTNVAGLLPWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 65/243 (27%)
Tryp_SPc 76..305 CDD:238113 66/244 (27%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 64/233 (27%)
Tryp_SPc 39..256 CDD:214473 62/231 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.