DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG4653

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:216 Identity:68/216 - (31%)
Similarity:105/216 - (48%) Gaps:27/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 CGGSLINDRYVLTAAHCVH-GNRDQ------ITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNR 161
            |||:||.::::|||||||. |...|      ..:|:..|.|.:  .|.:..:.:..:|.||..:.
  Fly    50 CGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLT--GGQLVPLSKIIIHTNYSSSD 112

  Fly   162 IV--NDVALLKLESPVPLTGNMRPVCL----PEANHNFDGKTAVVAGWGLIKEGGVTSNYLQEVN 220
            .|  ||:|||:||:.|.|..|..|:.|    |.|     |...:.:|||..:..|..|:.||...
  Fly   113 AVGSNDLALLELETSVVLNANTNPIDLATERPAA-----GSQIIFSGWGSSQVDGSLSHVLQVAT 172

  Fly   221 VPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIVNEGRYKLAGVVSFGY-GCA 284
            ...::.:.|:...|..:  |.:||...|.:.....|.||:|.|...|.   :|.|:.:|.. ||.
  Fly   173 RQSLSASDCQTELYLQQ--EDLLCLSPVDEDFAGLCSGDAGAPASYNN---QLVGIAAFFVSGCG 232

  Fly   285 QKNAPGVYARVSKFLDWIRKN 305
            .:...| |..|::.|:||.:|
  Fly   233 SEQPDG-YVDVTQHLEWINEN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 65/211 (31%)
Tryp_SPc 76..305 CDD:238113 67/214 (31%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 67/214 (31%)
Tryp_SPc 30..249 CDD:214473 65/211 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457758
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.