DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and HPN

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001362370.1 Gene:HPN / 3249 HGNCID:5155 Length:417 Species:Homo sapiens


Alignment Length:293 Identity:112/293 - (38%)
Similarity:149/293 - (50%) Gaps:34/293 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PHQTLAQQFADVVDVVDPAEQSIKAVRPPKSRNQCTAKQNCFCGTPNVNRIVGGQQVRSNKYPWT 90
            ||   .|:..:|:.|.|          .|:.|......|:|......|:|||||:.....::||.
Human   126 PH---TQRLLEVISVCD----------CPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQ 177

  Fly    91 AQL-VKGRHYPRLFCGGSLINDRYVLTAAHCV-HGNRDQITIRLLQIDRSSRDPGIVRKVVQTTV 153
            ..| ..|.|    .|||||::..:|||||||. ..||.....|:.....:...|..::..||..|
Human   178 VSLRYDGAH----LCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVV 238

  Fly   154 H-----PNYDPN--RIVNDVALLKLESPVPLTGNMRPVCLPEANHNF-DGKTAVVAGWGLIKEGG 210
            :     |..|||  ...||:||:.|.||:|||..::|||||.|.... |||...|.|||..:..|
Human   239 YHGGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYG 303

  Fly   211 VTSNYLQEVNVPVITNAQCRQTR-YKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIVNEG----- 269
            ..:..|||..||:|:|..|.... |.::|...|.||| ..:||.||||||||||.:..:.     
Human   304 QQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAG-YPEGGIDACQGDSGGPFVCEDSISRTP 367

  Fly   270 RYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302
            |::|.|:||:|.|||....||||.:||.|.:||
Human   368 RWRLCGIVSWGTGCALAQKPGVYTKVSDFREWI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 99/242 (41%)
Tryp_SPc 76..305 CDD:238113 100/243 (41%)
HPNNP_001362370.1 Hepsin-SRCR 51..159 CDD:401275 10/45 (22%)
Tryp_SPc 163..400 CDD:238113 98/241 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8579
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.