DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Tmprss11g

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_796136.2 Gene:Tmprss11g / 320454 MGIID:2444058 Length:417 Species:Mus musculus


Alignment Length:304 Identity:108/304 - (35%)
Similarity:163/304 - (53%) Gaps:24/304 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QYQAPHQ---TLAQQFADVVDVVDPAEQSI--KAVRPPKSRNQCTAKQ----NCFCGT----PNV 73
            ::|.|.:   ||.:|..:::.....:.|||  :....|..|....|:.    |..||:    |.:
Mouse   119 KFQIPRKNAGTLKRQADNILQEKLQSSQSILKRDASLPYLREMNAAQAEHILNSDCGSGMEYPPI 183

  Fly    74 NRIVGGQQVRSNKYPWTAQL-VKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDR 137
            .||..|:......:||.:.| |:|.|    .||.|||..::::|:||| ..|.....:..:...|
Mouse   184 ARIADGKPADKASWPWQSSLQVEGIH----LCGASLIGSQWLVTSAHC-FDNYKNPKLWTVSFGR 243

  Fly   138 SSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAV-VA 201
            :...|...|||....||.||..::..:|:|::||.|||..:.|:..||||:|......|:.| |.
Mouse   244 TLSSPLTTRKVESIIVHENYASHKHDDDIAVVKLSSPVLFSENLHRVCLPDATFQVLPKSKVFVT 308

  Fly   202 GWGLIKEGGVTSNYLQEVNVPVITNAQCRQTR-YKDKIAEVMLCAGLVQQGGKDACQGDSGGPLI 265
            |||.:|..|...|.||||.:.:|:|..|.|.. |...|:..|:|||.: .|..|||:|||||||:
Mouse   309 GWGALKANGPFPNSLQEVEIEIISNDVCNQVNVYGGAISSGMICAGFL-TGKLDACEGDSGGPLV 372

  Fly   266 VNEGRYK--LAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNTA 307
            :::.|.|  |.|:||:|..|.::|.||:|.||:.:.|||:..|:
Mouse   373 ISDNRNKWYLLGIVSWGIDCGKENKPGIYTRVTHYRDWIKSKTS 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 90/231 (39%)
Tryp_SPc 76..305 CDD:238113 91/233 (39%)
Tmprss11gNP_796136.2 SEA 48..142 CDD:279699 5/22 (23%)
Tryp_SPc 185..411 CDD:214473 90/231 (39%)
Tryp_SPc 186..414 CDD:238113 91/233 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.