DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG31780

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_723920.1 Gene:CG31780 / 318937 FlyBaseID:FBgn0051780 Length:464 Species:Drosophila melanogaster


Alignment Length:238 Identity:71/238 - (29%)
Similarity:116/238 - (48%) Gaps:23/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 PWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHG-NRDQITIRLLQIDRSSRD---PGI---V 145
            ||...|:..| ......||:||....|:||...... ...|:.:|..:.|.|::.   |.:   :
  Fly   119 PWMVALLDAR-TSSYVAGGALIAPHVVITARQRTENMTASQLVVRAGEWDFSTKTEQLPSVDVPI 182

  Fly   146 RKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAVVAGWGLIK-EG 209
            |.:|:   ||.::.....|:|||:.|...:..:.::.|:|:|.|..|||....:..|||... :.
  Fly   183 RSIVR---HPGFNLENGANNVALVFLRRSLTSSRHINPICMPSAPKNFDFSRCIFTGWGKNSFDD 244

  Fly   210 GVTSNYLQEVNVPVITNAQCRQ---TRYKD--KIAEVMLCAGLVQQGGKDACQGDSGGPLIV--- 266
            ....|.|:::::||:....|.|   ..|.:  ::...::|||  .:.|||:|:||.|.||..   
  Fly   245 PSYMNVLKKISLPVVQRRTCEQQLRLYYGNDFELDNSLMCAG--GEPGKDSCEGDGGSPLACAIK 307

  Fly   267 -NEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNTAD 308
             |..||:|||:|:||..|.....|.||..|:..::||...|.:
  Fly   308 DNPQRYELAGIVNFGVDCGLPGVPAVYTNVANVIEWITLTTVN 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 68/230 (30%)
Tryp_SPc 76..305 CDD:238113 70/233 (30%)
CG31780NP_723920.1 Tryp_SPc 113..344 CDD:214473 68/230 (30%)
Tryp_SPc 113..344 CDD:238113 68/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457664
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.