DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG32376

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:237 Identity:86/237 - (36%)
Similarity:127/237 - (53%) Gaps:22/237 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RIVGGQQVRSNKYPWTAQLVKGRHYPRLF-CGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDRS 138
            |||.|:::...:.|:...|    ||...| ||..:||..::|||.||..|..::.|:| :..|:.
  Fly    65 RIVNGKRIPCTEAPFQGSL----HYEGYFVCGCVIINKIWILTAHHCFFGPPEKYTVR-VGSDQQ 124

  Fly   139 SRDPGI--VRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAVVA 201
            .|...:  |:|:|....:.:|   .:.:|:|::||:|||.....:|||.||........|..||:
  Fly   125 RRGGQLRHVKKIVALAAYNDY---TMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKFVVS 186

  Fly   202 GWGLIKEGGV-TSNYLQEVNVPVITNAQCRQTRYKD---KIAEVMLCAGLVQQGGKDACQGDSGG 262
            |||:...... ...||:.|.:..|..::| |..||.   ||.:.|:||   .:..||:|.|||||
  Fly   187 GWGITSANAQNVQRYLRRVQIDYIKRSKC-QKMYKKAGLKIYKDMICA---SRTNKDSCSGDSGG 247

  Fly   263 PLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRK 304
            ||   ..|..|.|:||:|.|||.||.||||....:::.||:|
  Fly   248 PL---TSRGVLYGIVSWGIGCANKNYPGVYVNCKRYVPWIKK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 83/233 (36%)
Tryp_SPc 76..305 CDD:238113 85/236 (36%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 83/233 (36%)
Tryp_SPc 66..287 CDD:238113 85/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.