DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Tmprss6

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_006242057.1 Gene:Tmprss6 / 315388 RGDID:1307138 Length:811 Species:Rattus norvegicus


Alignment Length:255 Identity:109/255 - (42%)
Similarity:162/255 - (63%) Gaps:22/255 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KQNCFCGT--PNVNRIVGGQQVRSNKYPWTAQL-VKGRHYPRLFCGGSLINDRYVLTAAHCVHGN 124
            :::|.||.  |: :|||||......::||.|.| ::|||    .|||:||.||:|:|||||.  .
  Rat   563 EEHCDCGLQGPS-SRIVGGAMSSEGEWPWQASLQIRGRH----ICGGALIADRWVITAAHCF--Q 620

  Fly   125 RDQI------TIRLLQIDRSSRDPGIVR-KVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMR 182
            .|.:      |:.|.::.::||.||.|. ||.:..:||.::.:....|||||:|:.||..:..:|
  Rat   621 EDSMASPRLWTVFLGKMRQNSRWPGEVSFKVSRLFLHPYHEEDSHDYDVALLQLDHPVVYSATVR 685

  Fly   183 PVCLPEANHNFD-GKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAG 246
            |||||..:|.|: |:...:.|||..:|||..|:.||:|:|.:|....|.:. |:.::...|||||
  Rat   686 PVCLPARSHFFEPGQHCWITGWGAQREGGPGSSTLQKVDVQLIPQDLCNEA-YRYQVTPRMLCAG 749

  Fly   247 LVQQGGKDACQGDSGGPLIVNE--GRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRK 304
             .::|.||||||||||||:..|  ||:.|||:||:|.||.:.|..|||.||::.::||::
  Rat   750 -YRKGKKDACQGDSGGPLVCKEPSGRWFLAGLVSWGLGCGRPNFFGVYTRVTRVVNWIQQ 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 103/237 (43%)
Tryp_SPc 76..305 CDD:238113 104/240 (43%)
Tmprss6XP_006242057.1 SEA 88..185 CDD:279699
LDLa 459..489 CDD:238060
LDLa 495..525 CDD:238060
Ldl_recept_a 529..566 CDD:278486 0/2 (0%)
Tryp_SPc 576..806 CDD:214473 103/237 (43%)
Tryp_SPc 577..809 CDD:238113 104/240 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BJ04
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.