DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Tmprss3

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:257 Identity:104/257 - (40%)
Similarity:144/257 - (56%) Gaps:24/257 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 QCTAKQNCFCG--TPNVNRIVGGQQVRSNKYPWTAQL-VKGRHYPRLFCGGSLINDRYVLTAAHC 120
            :|:|     ||  |....|||||......::||...| .:|.|    .||||:|...:::|||||
  Rat   203 KCSA-----CGMRTGYSPRIVGGNVSSLTQWPWQVSLQFQGYH----LCGGSVITPLWIVTAAHC 258

  Fly   121 V----HGNRDQITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNM 181
            |    |.....:.:.|:.:..|.....:|.|::   .|..|.|.|:.||:||:||..|:.....:
  Rat   259 VYDLYHPKSWTVQVGLVSLMDSPVPSHLVEKII---YHSKYKPKRLGNDIALMKLSEPLTFDETI 320

  Fly   182 RPVCLPEANHNF-DGKTAVVAGWGLIKEG-GVTSNYLQEVNVPVITNAQC-RQTRYKDKIAEVML 243
            :|:|||.:..|| |||....:|||..::| |..|..|....||:|:|..| .:..|...|:..||
  Rat   321 QPICLPNSEENFPDGKLCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSML 385

  Fly   244 CAGLVQQGGKDACQGDSGGPLIVNEGR-YKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRK 304
            |||.: :||.|:|||||||||:..|.| :||.|..|||.|||:.|.||||.|::.|||||.:
  Rat   386 CAGYL-KGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWIHE 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 97/235 (41%)
Tryp_SPc 76..305 CDD:238113 98/238 (41%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055 4/12 (33%)
Tryp_SPc 216..444 CDD:214473 97/235 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H56985
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45531
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.