DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and HGF

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_000592.3 Gene:HGF / 3082 HGNCID:4893 Length:728 Species:Homo sapiens


Alignment Length:260 Identity:77/260 - (29%)
Similarity:117/260 - (45%) Gaps:51/260 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGTPNVNRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHC------------ 120
            |......|:|.|...|:| ..|...|   |:..:..||||||.:.:||||..|            
Human   487 CAKTKQLRVVNGIPTRTN-IGWMVSL---RYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAW 547

  Fly   121 -----VHGNRDQITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGN 180
                 |||..|:...::|.:.:      :|           |.|..  :|:.|:||..|..|...
Human   548 LGIHDVHGRGDEKCKQVLNVSQ------LV-----------YGPEG--SDLVLMKLARPAVLDDF 593

  Fly   181 MRPVCLPEANHNFDGKTAV-VAGW---GLIKEGGVTSNYLQEVNVPVITNAQCRQ-TRYKDKIAE 240
            :..:.||........||:. |.||   |||...|:    |:..::.::.|.:|.| .|.|..:.|
Human   594 VSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGL----LRVAHLYIMGNEKCSQHHRGKVTLNE 654

  Fly   241 VMLCAGLVQQGGKDACQGDSGGPLIVNEGRYKLA-GVVSFGYGCAQKNAPGVYARVSKFLDWIRK 304
            ..:||| .::.|...|:||.||||:..:.:.::. ||:..|.|||..|.||::.||:.:..||.|
Human   655 SEICAG-AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHK 718

  Fly   305  304
            Human   719  718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 73/249 (29%)
Tryp_SPc 76..305 CDD:238113 75/252 (30%)
HGFNP_000592.3 PAN_APPLE 39..122 CDD:238074
KR 126..208 CDD:214527
KR 210..290 CDD:214527
KR 304..384 CDD:214527
KR 388..470 CDD:238056
Tryp_SPc 494..716 CDD:214473 73/249 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.