DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Tpsg1

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:263 Identity:100/263 - (38%)
Similarity:140/263 - (53%) Gaps:45/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGTPNV----NRIVGGQQVRSNKYPWTAQLVKGRHYPRL----FCGGSLINDRYVLTAAHCVHGN 124
            ||.|.|    :|||||...::..:||.|.|       ||    .|||||::..:|||||||..|:
  Rat    18 CGQPQVSHAGSRIVGGHAAQAGAWPWQASL-------RLQKVHVCGGSLLSPEWVLTAAHCFSGS 75

  Fly   125 RD---------QITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGN 180
            .:         ::||.|      |.....|::::..:..|.  |.....|:||::|.:||.|:..
  Rat    76 VNSSDYEVHLGELTITL------SPHFSTVKQIIMYSSAPG--PPGSSGDIALVQLATPVALSSQ 132

  Fly   181 MRPVCLPEANHNF-DGKTAVVAGWGLIKEG-GVTSNY-LQEVNVPVITNAQCRQTRYKDK----I 238
            ::|||||||:.:| .|....|.|||..:|| .:...| |||..|.|:....|.|. |...    |
  Rat   133 VQPVCLPEASADFHPGMQCWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVETCSQA-YSSSNGSLI 196

  Fly   239 AEVMLCAGLVQQGGKDACQGDSGGPLIVN-EGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302
            ...||||    .|..||||.||||||:.. .|.::.|||||:|.||.:.:.|||||||:.:::||
  Rat   197 QSDMLCA----WGPGDACQDDSGGPLVCRVAGIWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWI 257

  Fly   303 RKN 305
            .::
  Rat   258 HRH 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 94/247 (38%)
Tryp_SPc 76..305 CDD:238113 95/249 (38%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 94/247 (38%)
Tryp_SPc 30..260 CDD:238113 95/249 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.