DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Prss29

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:265 Identity:96/265 - (36%)
Similarity:128/265 - (48%) Gaps:62/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 IVGGQQVRSNKYPWTAQLVKGRHYPRLF----------CGGSLINDRYVLTAAHCVHGNRDQITI 130
            ||||......|:||...|       |::          ||||:|:.::|||||||:|        
  Rat    31 IVGGNSAPQGKWPWQVSL-------RVYRYNWASWVHICGGSIIHPQWVLTAAHCIH-------- 80

  Fly   131 RLLQIDRSSRDPGIVR---------------KVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGN 180
                  .|..||...|               ||.:..:||::..:.:.:|||||:|...|....|
  Rat    81 ------ESDADPSAFRIYLGQVYLYGGEKLLKVSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPN 139

  Fly   181 MRPVCLPEANHNFDGKTAV-VAGWGLIK--EGGVTSNYLQEVNVPVITNAQCRQ-----TRYKDK 237
            ::||.|..|:.....|... |.|||.:.  |.......||:|.|.::.|..|.:     ||..:.
  Rat   140 VKPVKLSPASLEVTKKDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLSNH 204

  Fly   238 ----IAEVMLCAGLVQQGGKDACQGDSGGPLIVN-EGRYKLAGVVSFGYGCAQKNAPGVYARVSK 297
                |.:.|||||   ..|:|:|.|||||||:.| .|.:.|.||||:|||||.|:.|||||||..
  Rat   205 GQRLILQDMLCAG---SHGRDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALKDIPGVYARVQF 266

  Fly   298 FLDWI 302
            ||.||
  Rat   267 FLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 94/263 (36%)
Tryp_SPc 76..305 CDD:238113 96/265 (36%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.