DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Prss27

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:258 Identity:99/258 - (38%)
Similarity:138/258 - (53%) Gaps:30/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGTPNV-NRIVGGQQVRSNKYPWTAQLVK-GRHYPRLFCGGSLINDRYVLTAAHCVHGNRD---- 126
            ||.|.: ||:|||:.....::||...:.: |.|    |||||||...:|||||||.....|    
  Rat    29 CGHPRMFNRMVGGEDALEGEWPWQVSIQRNGAH----FCGGSLIAPTWVLTAAHCFSNTSDISIY 89

  Fly   127 QITIRLLQIDRSSRDPG---IVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPE 188
            |:.:..|::    :.||   :...|.:...||.|.......||||::|:.||..|..:.|||||:
  Rat    90 QVLLGALKL----QQPGPHALYVPVKRVKSHPEYQGMASSADVALVELQVPVTFTKYILPVCLPD 150

  Fly   189 ANHNF-DGKTAVVAGWGLIKEGGVTSN--YLQEVNVPVITNAQCRQTRYKDKIAEV--------M 242
            .:..| .|....|.|||...|.....|  .||::.||:|...:|.....||..|::        |
  Rat   151 PSVVFKSGMNCWVTGWGSPSEQDRLPNPRILQKLAVPLIDTPKCNLLYSKDAEADIQLKTIKDDM 215

  Fly   243 LCAGLVQQGGKDACQGDSGGPLI-VNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRK 304
            ||||.. :|.||||:|||||||: :.:..:..|||:|:|.|||::|.||||.||:....||.:
  Rat   216 LCAGFA-EGKKDACKGDSGGPLVCLVDQSWVQAGVISWGEGCARRNRPGVYIRVASHYQWIHQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 93/246 (38%)
Tryp_SPc 76..305 CDD:238113 94/249 (38%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 93/246 (38%)
Tryp_SPc 39..278 CDD:238113 94/248 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.