DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Prss3b

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:249 Identity:95/249 - (38%)
Similarity:142/249 - (57%) Gaps:41/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 NRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQ---- 134
            ::||||...:.|..|:...|..|.|    ||||||||.::|::||||.   :.:|.:||.:    
  Rat    23 DKIVGGYTCQKNSLPYQVSLNAGYH----FCGGSLINSQWVVSAAHCY---KSRIQVRLGEHNID 80

  Fly   135 --------IDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANH 191
                    ||.:        |:::   ||:|:.|...||:.|:||.||..|...:..|.||.:..
  Rat    81 VVEGGEQFIDAA--------KIIR---HPSYNANTFDNDIMLIKLNSPATLNSRVSTVSLPRSCG 134

  Fly   192 NFDGKTAVVAGWGLIKEGGVTSNY---LQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGK 253
            : .|...:|:|||.....|  :||   ||.::.||::::.|:.: |..||...|.|.|.: :|||
  Rat   135 S-SGTKCLVSGWGNTLSSG--TNYPSLLQCLDAPVLSDSSCKSS-YPGKITSNMFCLGFL-EGGK 194

  Fly   254 DACQGDSGGPLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNTA 307
            |:||||||||::.|.   :|.||||:|||||||..||||.:|..:::||::..|
  Rat   195 DSCQGDSGGPVVCNG---QLQGVVSWGYGCAQKGKPGVYTKVCNYVNWIQQTVA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 92/241 (38%)
Tryp_SPc 76..305 CDD:238113 94/243 (39%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 92/241 (38%)
Tryp_SPc 25..243 CDD:238113 94/243 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.