DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG33226

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:290 Identity:89/290 - (30%)
Similarity:129/290 - (44%) Gaps:58/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IKAVRPPKSRNQCTAKQNCFCGTPNV-NRIVGGQQVRSNKYPWTAQLV-KGRHYPRLFCGGSLIN 110
            |.|:|..:|..|.....||......| .:|:||.......:||..|:: :|.|    |||||||:
  Fly    18 ILALRSYESLGQDLLDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYH----FCGGSLIS 78

  Fly   111 DRYVLTAAHCVHGNRDQITIRLLQIDRSSRDPGIVRKVVQTTVH-----PNYDPNRIV------- 163
            ..:||||||| | :|.::.:|.      .|..||..:.:.::.:     |..|..||.       
  Fly    79 SLFVLTAAHC-H-SRYRLKVRF------GRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRD 135

  Fly   164 ---NDVALLKLESPVPLTGNMRPVCLPEANH-----NFDGKTAV--VAGWGLIKEGGVTSNYLQE 218
               .|:||..|..||......||:|:.:.::     .|....|:  |.|||. .|..:||..||.
  Fly   136 YHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGK-TESQLTSTILQT 199

  Fly   219 VNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPL---IVNEG--RYKLAGVVS 278
            .::..:....|.|. :..||....:|||..|   ...|.|||||||   :...|  |..|.|::|
  Fly   200 TSLFHLDRKFCAQI-FDRKIGWPHICAGHSQ---SSTCTGDSGGPLSAELTFSGVKRTVLFGIIS 260

  Fly   279 FGYGCAQKNAPG-----VYARVSKFLDWIR 303
            :|       ||.     |:..|.::.:|||
  Fly   261 YG-------APNCREVTVFTNVLRYSNWIR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 78/259 (30%)
Tryp_SPc 76..305 CDD:238113 81/261 (31%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 81/261 (31%)
Tryp_SPc 47..282 CDD:214473 78/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.