DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Tpsg1

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:256 Identity:100/256 - (39%)
Similarity:137/256 - (53%) Gaps:37/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGTPNV----NRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRD-- 126
            ||.|.|    :|||||....:..:||.|.|   |.:....|||||::..:|||||||..|:.:  
Mouse    75 CGHPQVSNSGSRIVGGHAAPAGTWPWQASL---RLHKVHVCGGSLLSPEWVLTAAHCFSGSVNSS 136

  Fly   127 -------QITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPV 184
                   ::|:.|      |.....|::::..|..|.  |.....|:||::|.|||.|:..::||
Mouse   137 DYQVHLGELTVTL------SPHFSTVKRIIMYTGSPG--PPGSSGDIALVQLSSPVALSSQVQPV 193

  Fly   185 CLPEANHNF-DGKTAVVAGWGLIKEG-GVTSNY-LQEVNVPVITNAQCRQTRYKDK----IAEVM 242
            |||||:.:| .|....|.|||...|| .:...| |||..|.|:....|.|. |...    |...|
Mouse   194 CLPEASADFYPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQA-YNSPNGSLIQPDM 257

  Fly   243 LCAGLVQQGGKDACQGDSGGPLIVN-EGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302
            |||    :|..||||.||||||:.. .|.::.|||||:|.||.:.:.|||||||:.:::||
Mouse   258 LCA----RGPGDACQDDSGGPLVCQVAGTWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 94/243 (39%)
Tryp_SPc 76..305 CDD:238113 95/244 (39%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 95/244 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842942
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.