DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and PRSS33

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:267 Identity:100/267 - (37%)
Similarity:138/267 - (51%) Gaps:40/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KQNCFCGTPNV-NRIVGGQQVRSNKYPWTAQLV-KGRHYPRLFCGGSLINDRYVLTAAHCV--HG 123
            :::..||.|.: :|||||:..|..::||.|.:. :|.|    .||||||..::|||||||.  ..
Human    23 RKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQHRGAH----VCGGSLIAPQWVLTAAHCFPRRA 83

  Fly   124 NRDQITIRLLQIDRSSRDPGI----VRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPV 184
            ...:..:||..:...|..|..    ||:|:   :.|:|..:....|:|||:|..||||:..::||
Human    84 LPAEYRVRLGALRLGSTSPRTLSVPVRRVL---LPPDYSEDGARGDLALLQLRRPVPLSARVQPV 145

  Fly   185 CLP-EANHNFDGKTAVVAGWGLIKEGGVTSNY--LQEVNVPVITNAQCRQTRYKDKIAEV----- 241
            ||| .......|....|.|||.::.|.....:  ||.|.||::.:..|      |.:..|     
Human   146 CLPVPGARPPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTC------DGLYHVGADVP 204

  Fly   242 ---------MLCAGLVQQGGKDACQGDSGGPL-IVNEGRYKLAGVVSFGYGCAQKNAPGVYARVS 296
                     .|||| ..||.|||||||||||| .:..|.:.|.||||:|.|||..|.||||..|:
Human   205 QAERIVLPGSLCAG-YPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSVA 268

  Fly   297 KFLDWIR 303
            .:..||:
Human   269 TYSPWIQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 95/251 (38%)
Tryp_SPc 76..305 CDD:238113 96/253 (38%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 95/251 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.