DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG30289

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:260 Identity:77/260 - (29%)
Similarity:112/260 - (43%) Gaps:43/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CG----TPNVNRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQI 128
            ||    .|.|..|.||.:....:.||...:...:.     ||||||..::||||||||  :.:.:
  Fly    30 CGISKDDPYVPNIFGGAKTNIQENPWMVLVWSSKP-----CGGSLIARQFVLTAAHCV--SFEDL 87

  Fly   129 TIRLLQIDRSSRDP----------------GIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPL 177
            .:||  .|..:.||                .:..|:    ||.||:...:.||:|||::...|..
  Fly    88 YVRL--GDYETLDPMPYCLNNHCIPKFYNISVDMKI----VHENYNGITLQNDIALLRMSEAVEY 146

  Fly   178 TGNMRPVCLPEANHNFDGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVM 242
            :..:||:||.............|.||| ..|.|..|..|....:..:..:.| ..::..:.....
  Fly   147 SDYVRPICLLVGEQMQSIPMFTVTGWG-ETEYGQFSRILLNATLYNMDISYC-NIKFNKQADRSQ 209

  Fly   243 LCAGLVQQGGKDACQGDSGGPLI--VNEGRYKLA---GVVSFGYGCAQKNAPGVYARVSKFLDWI 302
            :|||   ....:.|:|||||||.  .:.|...|:   |:||:|......|..|||..||...:||
  Fly   210 ICAG---SHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERCAANVAGVYTNVSYHREWI 271

  Fly   303  302
              Fly   272  271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 71/247 (29%)
Tryp_SPc 76..305 CDD:238113 73/248 (29%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 71/246 (29%)
Tryp_SPc 42..271 CDD:238113 71/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.