DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG30083

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:246 Identity:83/246 - (33%)
Similarity:123/246 - (50%) Gaps:26/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGTPNVN-RIVGGQQVRSNKYPWTAQLVK--GRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQIT 129
            ||.|::: :|:.||...:...||.|.:.|  .:....|.|||:||:.::||:||||:  .||||.
  Fly    25 CGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCI--KRDQIL 87

  Fly   130 IRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCL---PEANH 191
            ...|....|||    ...|.:...:..:......||:.:|:::..|.....:||:|:   |....
  Fly    88 AVRLGEHSSSR----YFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVP 148

  Fly   192 NFDGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGKDAC 256
            |.  ||...||||. .|....|..|:.|.:..:..::|....:.: :.|..:|||   ....|.|
  Fly   149 NV--KTFKAAGWGK-TENETFSKVLKTVELNELNASECYNMLWVN-VTESQICAG---HPDGDTC 206

  Fly   257 QGDSGGPLI---VNEG--RYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302
            .||||||||   ..:|  ||...|::|||....  |:||||.|:|.|:|||
  Fly   207 AGDSGGPLIHPVYMDGSLRYVQLGIISFGSSLC--NSPGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 78/236 (33%)
Tryp_SPc 76..305 CDD:238113 80/237 (34%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 78/236 (33%)
Tryp_SPc 34..255 CDD:238113 78/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.