DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and CG30025

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster


Alignment Length:238 Identity:88/238 - (36%)
Similarity:128/238 - (53%) Gaps:22/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RIVGGQQVRSNKYPWTAQLVK-GRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDRS 138
            |||||.....:.:||...|.: |.|    .||||:.:...::|||||:    ..::..:|||...
  Fly    30 RIVGGSATTISSFPWQISLQRSGSH----SCGGSIYSSNVIVTAAHCL----QSVSASVLQIRAG 86

  Fly   139 S---RDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAVV 200
            |   ...|:...|.....|..|:.|.:|||:|::|:...:..:..::.:.|..:| ..:|..|.|
  Fly    87 SSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSN-PANGAAASV 150

  Fly   201 AGWGLIKEGGVT-SNYLQEVNVPVITNAQCRQTR--YKDKIAEVMLCAGLVQQGGKDACQGDSGG 262
            :|||.:..|..: .:.||.|||.:::.:||..:.  |..:|...|:||.   ..|||||||||||
  Fly   151 SGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA---ASGKDACQGDSGG 212

  Fly   263 PLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKN 305
            || |:.|  .|.||||:|||||..|.|||||.|:....|:..|
  Fly   213 PL-VSGG--VLVGVVSWGYGCAYSNYPGVYADVAALRSWVINN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 86/233 (37%)
Tryp_SPc 76..305 CDD:238113 86/235 (37%)
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 86/233 (37%)
Tryp_SPc 31..252 CDD:238113 86/235 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.