DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Mst1

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_038936729.1 Gene:Mst1 / 24566 RGDID:3114 Length:747 Species:Rattus norvegicus


Alignment Length:312 Identity:96/312 - (30%)
Similarity:140/312 - (44%) Gaps:50/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 APHQTLAQQFADVVD---------VVDP-------AEQSIKAVRPPKSRNQCTAKQNCFCG---- 69
            |||..|...|....|         .:||       |.:.....:||...:.....|...||    
  Rat   449 APHAGLEANFCRNPDGDSHGPWCYTLDPETLFDYCALKRCDDDQPPSILDPPVQVQFEKCGKRVD 513

  Fly    70 TPNVNRIVGGQQVRSNKYPWTAQL--VKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQIT--- 129
            ..|..|:|||....|   |||..|  .:|:|    ||||||:.:::||||..|:....|.:|   
  Rat   514 QSNRLRVVGGHPGNS---PWTVSLRNRQGQH----FCGGSLVKEQWVLTARQCIWSCHDPLTGYE 571

  Fly   130 IRLLQIDRSSRDPGIVR----KVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEAN 190
            :.|..|:::.: ||...    .|.:|...|      ..:.:.|||||.||.|..::..:|||...
  Rat   572 VWLGTINQNPQ-PGEANLQRVSVAKTVCGP------AGSQLVLLKLERPVILNHHVARICLPPEQ 629

  Fly   191 HNF-DGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCA-GLVQQGGK 253
            :.. .|....:||||..| |...|..|....:.||::.:| ..:|:.::.|..:|. ||:...| 
  Rat   630 YVVPPGTNCEIAGWGESK-GTSNSTVLHVAKMKVISSQEC-NVKYRRRVQESEICTEGLLAPTG- 691

  Fly   254 DACQGDSGGPL-IVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRK 304
             ||:||.|||| ......:.|.|::.....||:...|.::.|||.|:|||.|
  Rat   692 -ACEGDYGGPLACYTHDCWVLQGLIIPNRVCARPRWPAIFTRVSVFVDWINK 742

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 78/238 (33%)
Tryp_SPc 76..305 CDD:238113 80/241 (33%)
Mst1XP_038936729.1 PAN_1 32..111 CDD:394981
KR 116..196 CDD:214527
KR 199..276 CDD:214527
KR 321..403 CDD:214527
KR 408..490 CDD:214527 9/40 (23%)
Tryp_SPc 520..743 CDD:238113 80/241 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.