DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Ctrb1

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_036668.1 Gene:Ctrb1 / 24291 RGDID:2444 Length:263 Species:Rattus norvegicus


Alignment Length:261 Identity:88/261 - (33%)
Similarity:137/261 - (52%) Gaps:31/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NCF--------CGTPNV-------NRIVGGQQVRSNKYPWTAQL--VKGRHYPRLFCGGSLINDR 112
            :||        ||.|.:       :|||.|:......:||...|  ..|.|    |||||||::.
  Rat     8 SCFALVGATFGCGVPTIQPVLTGLSRIVNGEDAIPGSWPWQVSLQDKTGFH----FCGGSLISED 68

  Fly   113 YVLTAAHCVHGNRDQITIRLLQIDRSSRDPGI-VRKVVQTTVHPNYDPNRIVNDVALLKLESPVP 176
            :|:|||||  |.:....:...:.|:.|.:..| |.|:.|...:|.::...:.||:.||||.:|..
  Rat    69 WVVTAAHC--GVKTSDVVVAGEFDQGSDEENIQVLKIAQVFKNPKFNMFTVRNDITLLKLATPAQ 131

  Fly   177 LTGNMRPVCLPEANHNF-DGKTAVVAGWGLIKEGGV-TSNYLQEVNVPVITNAQCRQTRYKDKIA 239
            .:..:..||||..:.:| .|......|||..|...: |...||:..:|:::.|.|::: :..||.
  Rat   132 FSETVSAVCLPNVDDDFPPGTVCATTGWGKTKYNALKTPEKLQQAALPIVSEADCKKS-WGSKIT 195

  Fly   240 EVMLCAGLVQQGGKDACQGDSGGPLIV-NEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIR 303
            :||.|||   ..|..:|.|||||||:. .:|.:.|||:||:|.|....:.|.||:||:..:.|::
  Rat   196 DVMTCAG---ASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWGSGVCSTSTPAVYSRVTALMPWVQ 257

  Fly   304 K 304
            :
  Rat   258 Q 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 82/232 (35%)
Tryp_SPc 76..305 CDD:238113 82/235 (35%)
Ctrb1NP_036668.1 Tryp_SPc 33..256 CDD:214473 82/232 (35%)
Tryp_SPc 34..259 CDD:238113 82/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.