DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Prss2

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_033456.1 Gene:Prss2 / 22072 MGIID:102759 Length:246 Species:Mus musculus


Alignment Length:241 Identity:97/241 - (40%)
Similarity:141/241 - (58%) Gaps:23/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 NRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQI-----TIRLL 133
            ::||||...|.:..|:...|..|.|    |||||||||::|::|||| :..|.|:     .|.:|
Mouse    22 DKIVGGYTCRESSVPYQVSLNAGYH----FCGGSLINDQWVVSAAHC-YKYRIQVRLGEHNINVL 81

  Fly   134 QIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTA 198
            :.:....|..   |:::   ||||:...:.||:.|:||.|||.|...:..|.||.:... .|...
Mouse    82 EGNEQFVDSA---KIIR---HPNYNSWTLDNDIMLIKLASPVTLNARVASVPLPSSCAP-AGTQC 139

  Fly   199 VVAGWGLIKEGGVTS-NYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGKDACQGDSGG 262
            :::|||.....||.: :.||.|:.||:..|.| :..|...|...|:|.|.: :||||:|||||||
Mouse   140 LISGWGNTLSNGVNNPDLLQCVDAPVLPQADC-EASYPGDITNNMICVGFL-EGGKDSCQGDSGG 202

  Fly   263 PLIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNTAD 308
            |::.|.   :|.|:||:||||||.:|||||.:|..::|||:...||
Mouse   203 PVVCNG---ELQGIVSWGYGCAQPDAPGVYTKVCNYVDWIQNTIAD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 93/232 (40%)
Tryp_SPc 76..305 CDD:238113 95/234 (41%)
Prss2NP_033456.1 Tryp_SPc 23..239 CDD:214473 93/232 (40%)
Tryp_SPc 24..242 CDD:238113 95/234 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.