DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Prss27

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_780649.1 Gene:Prss27 / 213171 MGIID:2450123 Length:328 Species:Mus musculus


Alignment Length:258 Identity:99/258 - (38%)
Similarity:138/258 - (53%) Gaps:30/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGTPNV-NRIVGGQQVRSNKYPWTAQLVK-GRHYPRLFCGGSLINDRYVLTAAHCVHGNRD---- 126
            ||.|.: ||:|||:.....::||...:.: |.|    |||||||...:|||||||.....|    
Mouse    29 CGHPKMFNRMVGGENALEGEWPWQVSIQRNGIH----FCGGSLIAPTWVLTAAHCFSNTSDISIY 89

  Fly   127 QITIRLLQIDRSSRDPG---IVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPE 188
            |:.:..|::    :.||   :...|.|...:|.|.......||||::|:.||..|..:.|||||:
Mouse    90 QVLLGALKL----QQPGPHALYVPVKQVKSNPQYQGMASSADVALVELQGPVTFTNYILPVCLPD 150

  Fly   189 ANHNFD-GKTAVVAGWGLIKEGGVTSN--YLQEVNVPVITNAQCRQTRYKD--------KIAEVM 242
            .:..|: |....|.|||...|.....|  .||::.||:|...:|.....||        .|.:.|
Mouse   151 PSVIFESGMNCWVTGWGSPSEQDRLPNPRVLQKLAVPIIDTPKCNLLYNKDVESDFQLKTIKDDM 215

  Fly   243 LCAGLVQQGGKDACQGDSGGPLI-VNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRK 304
            ||||.. :|.||||:|||||||: :.:..:..|||:|:|.|||::|.||||.||:....||.:
Mouse   216 LCAGFA-EGKKDACKGDSGGPLVCLVDQSWVQAGVISWGEGCARRNRPGVYIRVTSHHKWIHQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 93/246 (38%)
Tryp_SPc 76..305 CDD:238113 94/249 (38%)
Prss27NP_780649.1 Tryp_SPc 37..275 CDD:214473 93/246 (38%)
Tryp_SPc 39..278 CDD:238113 94/248 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.