DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Tmprss11a

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_006534903.1 Gene:Tmprss11a / 194597 MGIID:2684853 Length:392 Species:Mus musculus


Alignment Length:296 Identity:97/296 - (32%)
Similarity:150/296 - (50%) Gaps:31/296 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ADVVDVVDP--------AEQSIKAVRPPKSRN------QCTAKQNCFCGTPNV----NRIVGGQQ 81
            ||:|.|..|        .:::..::...|:||      ..:..|...||...:    ||||.|..
Mouse   102 ADIVMVFQPPATGRRTVGKKTHHSILDQKTRNARALPADVSLVQVKDCGKRAIPLIANRIVSGNP 166

  Fly    82 VRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHC--VHGNRDQITIRLLQIDRSSRDPGI 144
            .....:||...|.:...:.   |||:||.:.:|:|||||  .:.|..|.|   |....:...|.:
Mouse   167 AAKGAWPWQVSLQRSNIHQ---CGGTLIGNMWVVTAAHCFRTNSNPRQWT---LSFGTTINPPLM 225

  Fly   145 VRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNF-DGKTAVVAGWGLIKE 208
            .|.|.:..:|..|.|....:|:||::....|..:..:|.:||||.:.:| ...|..:.|:|.:..
Mouse   226 KRDVRRIIMHERYRPPARDHDIALVQFSPRVTFSDEVRRICLPEPSASFPPNSTVYITGFGALYY 290

  Fly   209 GGVTSNYLQEVNVPVITNAQCRQTR-YKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIV--NEGR 270
            ||.:.|.|:|..|.:|:|..|::.. |.::|...|.|||.: :|..|||:|||||||::  |:..
Mouse   291 GGESQNELREARVQIISNDICKKRHVYGNEIKRGMFCAGFL-EGNYDACRGDSGGPLVIRDNKDT 354

  Fly   271 YKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNT 306
            :.|.|:||:|..|.|||.||||.:|:.:..||...|
Mouse   355 WYLIGIVSWGDNCGQKNKPGVYTQVTYYRHWIASKT 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 82/232 (35%)
Tryp_SPc 76..305 CDD:238113 83/234 (35%)
Tmprss11aXP_006534903.1 SEA 42..135 CDD:366610 8/32 (25%)
Tryp_SPc 161..389 CDD:238113 83/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8807
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.