DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and svh-1

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:269 Identity:82/269 - (30%)
Similarity:134/269 - (49%) Gaps:31/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SRNQCTAKQNCFCGTPNVN----------RIVGGQQVRSNKYPWTAQL----VKGRHYPRLFCGG 106
            |:|..::...|......||          |:|||.:.....:||||.|    .|..|     ||.
 Worm   683 SQNGMSSASQCGLRYVEVNARDAAKSRIARVVGGFETVPGAFPWTAALRNKATKAHH-----CGA 742

  Fly   107 SLINDRYVLTAAHCVHGNRDQITIRLLQID-RSSRDPGIVRKVVQTTVH--PNYDPNRIVNDVAL 168
            |:::..:::|||||...:....:..::..| .:::..|..:......:|  |.| .:...:|:|:
 Worm   743 SILDKTHLITAAHCFEEDERVSSYEVVVGDWDNNQTDGNEQIFYLQRIHFYPLY-KDIFSHDIAI 806

  Fly   169 LKLESP-VPLTGNMRPVCLPEANHNF-DGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQC-R 230
            |::..| :......:|:|||..:..: .|:..||:|||.:  |...:..||...:|:|....| .
 Worm   807 LEIPYPGIEFNEYAQPICLPSKDFVYTPGRQCVVSGWGSM--GLRYAERLQAALIPIINRFDCVN 869

  Fly   231 QTRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIV--NEGRYKLAGVVSFGYGCAQKNAPGVYA 293
            .::....::....|||.: :||.|:||||||||...  .:|.:.||||:|:|.|||||..||:|.
 Worm   870 SSQIYSSMSRSAFCAGYL-EGGIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQKKQPGIYT 933

  Fly   294 RVSKFLDWI 302
            .|:.:|.||
 Worm   934 MVAPYLSWI 942

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 75/238 (32%)
Tryp_SPc 76..305 CDD:238113 76/239 (32%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 76/239 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.