DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Tpsb2

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:323 Identity:110/323 - (34%)
Similarity:154/323 - (47%) Gaps:84/323 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLGIGLS-LAQYQYQAPHQTLAQQFADVVDVVDPAEQSIKAVRPPKSRNQCTAKQNCFCGTPN 72
            ||||...|| ||...|.||.               ||.|.:                        
Mouse     5 LLLLLWALSLLASLVYSAPR---------------PANQRV------------------------ 30

  Fly    73 VNRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGN-----------RD 126
              .||||.:...:|:||...|....:|...|||||||:.::||||||||..:           |:
Mouse    31 --GIVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTAAHCVGPHIKSPQLFRVQLRE 93

  Fly   127 QITI---RLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPE 188
            |...   :||.::|             ..|||:|.......|||||:||.||.::.::.|:.||.
Mouse    94 QYLYYGDQLLSLNR-------------IVVHPHYYTAEGGADVALLELEVPVNVSTHLHPISLPP 145

  Fly   189 ANHNF-DGKTAVVAGWGLI-KEGGVTSNY-LQEVNVPVITNAQCRQTRYKDK--------IAEVM 242
            |:..| .|.:..|.|||.| .:..:...| |::|.||::.|:.|.:..:...        :.:.|
Mouse   146 ASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCDRKYHTGLYTGDDFPIVHDGM 210

  Fly   243 LCAGLVQQGGKDACQGDSGGPLIVN-EGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRK 304
            ||||..:   :|:|||||||||:.. :|.:..|||||:|.||||.|.||:|.||:.:||||.:
Mouse   211 LCAGNTR---RDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWIHR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 94/252 (37%)
Tryp_SPc 76..305 CDD:238113 96/255 (38%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 96/253 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842976
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.