DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Mst1

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_032269.3 Gene:Mst1 / 15235 MGIID:96080 Length:716 Species:Mus musculus


Alignment Length:293 Identity:91/293 - (31%)
Similarity:130/293 - (44%) Gaps:74/293 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VVDPAEQSIKAVRPPKSRNQCTAKQNCF--CG----TPNVNRIVGGQQVRSNKYPWTAQL--VKG 96
            ::||.:|.:                  |  ||    ..|..|:|||....|   |||..|  .:|
Mouse   465 ILDPPDQVV------------------FEKCGKRVDKSNKLRVVGGHPGNS---PWTVSLRNRQG 508

  Fly    97 RHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDP-- 159
            :|    ||||||:.:::||||..|:.               |..:|....:|...|::.|..|  
Mouse   509 QH----FCGGSLVKEQWVLTARQCIW---------------SCHEPLTGYEVWLGTINQNPQPGE 554

  Fly   160 ---NRIV----------NDVALLKLESPVPLTGNMRPVCLPEANHNF-DGKTAVVAGWGLIKEGG 210
               .|:.          :.:.|||||.||.|..::..:|||...:.. .|....:||||   |..
Mouse   555 ANLQRVPVAKAVCGPAGSQLVLLKLERPVILNHHVALICLPPEQYVVPPGTKCEIAGWG---ESI 616

  Fly   211 VTSN--YLQEVNVPVITNAQCRQTRYKDKIAEVMLCA-GLVQQGGKDACQGDSGGPL-IVNEGRY 271
            .|||  .|...::.||:|.:| .|:|:..|.|..:|. |||...|  ||:||.|||| ......:
Mouse   617 GTSNNTVLHVASMNVISNQEC-NTKYRGHIQESEICTQGLVVPVG--ACEGDYGGPLACYTHDCW 678

  Fly   272 KLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRK 304
            .|.|::.....||:...|.::.|||.|:|||.|
Mouse   679 VLQGLIIPNRVCARPRWPAIFTRVSVFVDWINK 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 81/248 (33%)
Tryp_SPc 76..305 CDD:238113 83/251 (33%)
Mst1NP_032269.3 PAN_1 25..96 CDD:278453
KR 108..188 CDD:214527
KR 191..269 CDD:214527
KR 291..372 CDD:214527
KR 377..459 CDD:214527
Tryp_SPc 488..709 CDD:214473 81/248 (33%)
Tryp_SPc 489..712 CDD:238113 83/251 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.