DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Tmprss3

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001157248.1 Gene:Tmprss3 / 140765 MGIID:2155445 Length:475 Species:Mus musculus


Alignment Length:259 Identity:105/259 - (40%)
Similarity:145/259 - (55%) Gaps:29/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 QCTAKQNCFCGT-----PNVNRIVGGQQVRSNKYPWTAQL-VKGRHYPRLFCGGSLINDRYVLTA 117
            :|:|     |||     |   |||||......::||...| .:|.|    .||||:|...:::||
Mouse   225 KCSA-----CGTRTGYSP---RIVGGNMSSLTQWPWQVSLQFQGYH----LCGGSIITPLWIVTA 277

  Fly   118 AHCV----HGNRDQITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLT 178
            ||||    |.....:.:.|:.:..|.....:|.|::   .|..|.|.|:.||:||:||..|:...
Mouse   278 AHCVYDLYHPKSWTVQVGLVSLMDSPVPSHLVEKII---YHSKYKPKRLGNDIALMKLSEPLTFD 339

  Fly   179 GNMRPVCLPEANHNF-DGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQC-RQTRYKDKIAEV 241
            ..::|:|||.:..|| |||....:|||..::||..|..|....||:|:|..| .:..|...|:..
Mouse   340 ETIQPICLPNSEENFPDGKLCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISPS 404

  Fly   242 MLCAGLVQQGGKDACQGDSGGPLIVNEGR-YKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRK 304
            |||||.: :||.|:|||||||||:..|.| :||.|..|||.|||:.|.||||.|::.|||||.:
Mouse   405 MLCAGYL-KGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWIHE 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 97/234 (41%)
Tryp_SPc 76..305 CDD:238113 98/237 (41%)
Tmprss3NP_001157248.1 LDLa 96..129 CDD:238060
SRCR_2 134..233 CDD:292133 5/12 (42%)
Tryp_SPc 238..465 CDD:214473 97/234 (41%)
Tryp_SPc 239..468 CDD:238113 98/237 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H56985
Inparanoid 1 1.050 179 1.000 Inparanoid score I3996
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11120
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.