DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and TMPRSS11B

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_872308.2 Gene:TMPRSS11B / 132724 HGNCID:25398 Length:416 Species:Homo sapiens


Alignment Length:294 Identity:107/294 - (36%)
Similarity:150/294 - (51%) Gaps:29/294 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HQTLAQQFADVVDVVDPAEQSIKAVRPPKSRNQCTAKQNCFCGTPNVNRIVGGQQVRSNK----- 86
            ||.|....|....|  ||  |||.:...|:.::... .|| ||....|.|:.|.::.:.|     
Human   136 HQMLKNNMASWNAV--PA--SIKLMEISKAASEMLT-NNC-CGRQVANSIITGNKIVNGKSSLEG 194

  Fly    87 -YPWTAQLV-KGRHYPRLFCGGSLINDRYVLTAAHCV--HGNRDQITIRL-LQIDRSSRDPGIVR 146
             :||.|.:. |||||    ||.|||:.|::|:||||.  ..|....|:.. :.:::    |.:.|
Human   195 AWPWQASMQWKGRHY----CGASLISSRWLLSAAHCFAKKNNSKDWTVNFGIVVNK----PYMTR 251

  Fly   147 KVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNF-DGKTAVVAGWGLIKEGG 210
            ||.....|.||....:.:|:||::|...|..|..:|.:|||||.... :....||.|||.:...|
Human   252 KVQNIIFHENYSSPGLHDDIALVQLAEEVSFTEYIRKICLPEAKMKLSENDNVVVTGWGTLYMNG 316

  Fly   211 VTSNYLQEVNVPVITNAQCRQT-RYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIVNEGR--YK 272
            .....|||..:.:|.|..|..: .|...:.:.|||||.: .|..||||.||||||...:.|  :.
Human   317 SFPVILQEDFLKIIDNKICNASYAYSGFVTDTMLCAGFM-SGEADACQNDSGGPLAYPDSRNIWH 380

  Fly   273 LAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNT 306
            |.|:||:|.||.:||.||||.||:.:.:||...|
Human   381 LVGIVSWGDGCGKKNKPGVYTRVTSYRNWITSKT 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 88/240 (37%)
Tryp_SPc 76..305 CDD:238113 90/242 (37%)
TMPRSS11BNP_872308.2 SEA 45..143 CDD:279699 3/6 (50%)
Tryp_SPc 184..410 CDD:214473 86/234 (37%)
Tryp_SPc 185..413 CDD:238113 88/236 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41415
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.