DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and AgaP_AGAP005671

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_315688.1 Gene:AgaP_AGAP005671 / 1276351 VectorBaseID:AGAP005671 Length:300 Species:Anopheles gambiae


Alignment Length:252 Identity:83/252 - (32%)
Similarity:123/252 - (48%) Gaps:29/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 NRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQI----TIRLLQ 134
            :||..||:....::|:...|:.........||||::.:.::|||||||......:    |..:..
Mosquito    53 HRITNGQEATPGQFPYQIALLSEFATGTGLCGGSVLTNTFILTAAHCVVSGATTLARGGTAIMGA 117

  Fly   135 IDRSSRDP----------GIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEA 189
            .:|:..:|          ||:|       ||.|....|.||:|:::|:..:.....::|..||..
Mosquito   118 HNRNVNEPSQQRIRFSTGGIIR-------HPQYSTTNIRNDIAVVRLDGTIVFNTRVQPARLPAR 175

  Fly   190 N--HNFDGKTAVVAGWGLIKEG-GVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQG 251
            :  ..|.|.|..|:|:|...:| ..||..::....||:|||.|........|....:|  |..:|
Mosquito   176 SDTRQFGGFTGTVSGFGRTSDGSSATSAVVRFTRNPVMTNADCIARWNTALIQPQNVC--LSGEG 238

  Fly   252 GKDACQGDSGGPLIVNEGRYKLAGVVSFG--YGCAQKNAPGVYARVSKFLDWIRKNT 306
            |:.:|.|||||||.|.:|.....|:||||  .||: ...|.||||||.||.||..|:
Mosquito   239 GRSSCNGDSGGPLTVQDGGSLQIGIVSFGSAAGCS-IGMPSVYARVSFFLPWIEANS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 80/245 (33%)
Tryp_SPc 76..305 CDD:238113 81/247 (33%)
AgaP_AGAP005671XP_315688.1 Tryp_SPc 54..290 CDD:214473 80/245 (33%)
Tryp_SPc 55..293 CDD:238113 81/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.