DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Acr

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_038483.1 Gene:Acr / 11434 MGIID:87884 Length:436 Species:Mus musculus


Alignment Length:261 Identity:93/261 - (35%)
Similarity:127/261 - (48%) Gaps:29/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KQNCFCGTPNVNRIVGGQQVRSNKYPWTAQL-VKGRHYPRLF--CGGSLINDRYVLTAAHCVHGN 124
            :||...||    |||.||..:...:||...| :...|..|.:  |||||:|..:|||||||....
Mouse    34 RQNSQAGT----RIVSGQSAQLGAWPWMVSLQIFTSHNSRRYHACGGSLLNSHWVLTAAHCFDNK 94

  Fly   125 RDQITIRLL----QID----RSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNM 181
            :.....||:    :|:    :..::|...|.|.:..:|..|:.....||:||||:..||.....:
Mouse    95 KKVYDWRLVFGAQEIEYGRNKPVKEPQQERYVQKIVIHEKYNVVTEGNDIALLKITPPVTCGNFI 159

  Fly   182 RPVCLPEANHNFDG-----KTAVVAGWGLIKEGGV-TSNYLQEVNVPVITNAQCRQTR-YKDKIA 239
            .|.|||   |...|     .|..|.|||.|||... .|..|.|..|.:|....|..|: |..::.
Mouse   160 GPCCLP---HFKAGPPQIPHTCYVTGWGYIKEKAPRPSPVLMEARVDLIDLDLCNSTQWYNGRVT 221

  Fly   240 EVMLCAGLVQQGGKDACQGDSGGPLIVN---EGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDW 301
            ...:||| ..:|..|.|||||||||:..   :..:.:.|:.|:|.|||:...||||.....:|||
Mouse   222 STNVCAG-YPEGKIDTCQGDSGGPLMCRDNVDSPFVVVGITSWGVGCARAKRPGVYTATWDYLDW 285

  Fly   302 I 302
            |
Mouse   286 I 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 87/247 (35%)
Tryp_SPc 76..305 CDD:238113 88/248 (35%)
AcrNP_038483.1 Tryp_SPc 42..286 CDD:214473 87/247 (35%)
Tryp_SPc 43..289 CDD:238113 88/248 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4320
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.