DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and PRSS21

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:329 Identity:107/329 - (32%)
Similarity:147/329 - (44%) Gaps:81/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LALPLLLLGIGLSLAQYQYQAPHQTLAQQFADVVDVVDPAEQSIKAVRPPKSRNQCTAKQNCFCG 69
            |.|.|||...||...:.|..||                        :..|..|...|        
Human     7 LLLALLLARAGLRKPESQEAAP------------------------LSGPCGRRVIT-------- 39

  Fly    70 TPNVNRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRLLQ 134
                :|||||:.....::||...|   |.:....||.||::.|:.||||||.....|        
Human    40 ----SRIVGGEDAELGRWPWQGSL---RLWDSHVCGVSLLSHRWALTAAHCFETYSD-------- 89

  Fly   135 IDRSSRDP-GIVRKVVQTTVHPNY-----------------DPNRIVN---DVALLKLESPVPLT 178
                ..|| |.:.:..|.|..|::                 .|..:.|   |:||:||.:||..|
Human    90 ----LSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYT 150

  Fly   179 GNMRPVCLPEANHNFDGKT-AVVAGWGLIKEGGV--TSNYLQEVNVPVITNAQCR----QTRYKD 236
            .:::|:||..:...|:.:| ..|.|||.|||...  :.:.||||.|.:|.|:.|.    :..::.
Human   151 KHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRK 215

  Fly   237 KIAEVMLCAGLVQQGGKDACQGDSGGPLIVNE-GRYKLAGVVSFGYGCAQKNAPGVYARVSKFLD 300
            .|...|:|||.. |||||||.|||||||..|: |.:...||||:|.||.:.|.||||..:|...:
Human   216 DIFGDMVCAGNA-QGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFE 279

  Fly   301 WIRK 304
            ||:|
Human   280 WIQK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 91/255 (36%)
Tryp_SPc 76..305 CDD:238113 93/258 (36%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 92/256 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.