DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and LOC101734975

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_004918402.1 Gene:LOC101734975 / 101734975 -ID:- Length:251 Species:Xenopus tropicalis


Alignment Length:236 Identity:93/236 - (39%)
Similarity:129/236 - (54%) Gaps:28/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 PWTAQLVK-GRHYPRLFCGGSLINDRYVLTAAHCVHG----NRDQITIRLLQIDRSSRDPGIVRK 147
            ||...|.| |.|    .|||||||:::.::||||..|    :..::.:...|:...|   ||...
 Frog     6 PWQLSLRKLGLH----ICGGSLINNQWAISAAHCFAGPIRVSDYKVNLGAYQLSVPS---GIFVD 63

  Fly   148 VVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNF-DGKTAVVAGWGLIKEGGV 211
            |....|||.:.....:.|:||:||.:||..|..:.|||:|..|..| ||...:|:|||.|.: .|
 Frog    64 VAAVYVHPTFKGAGSIGDIALIKLANPVQFTDYIIPVCIPTQNVVFPDGMNCIVSGWGTINQ-QV 127

  Fly   212 TSNY---LQEVNVPVITNAQCRQ---------TRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPL 264
            :..|   ||:|.||:|..|.|.|         ..|:..|...|:||| .:.|.:.:|||||||||
 Frog   128 SLPYPKTLQKVRVPIIGRASCDQMYHINNPTLPPYQSIIMWDMICAG-YKAGRRGSCQGDSGGPL 191

  Fly   265 IVN-EGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRK 304
            :.. .|.:.|||:||:|:||||.|.||||..|..:..||::
 Frog   192 VCPWNGSWLLAGIVSWGFGCAQPNKPGVYTSVPAYSAWIQE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 91/232 (39%)
Tryp_SPc 76..305 CDD:238113 93/236 (39%)
LOC101734975XP_004918402.1 Tryp_SPc 2..232 CDD:238113 93/234 (40%)
Tryp_SPc 2..230 CDD:214473 91/232 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.