DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and tmprss2.14

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_031752402.1 Gene:tmprss2.14 / 101731505 XenbaseID:XB-GENE-22065937 Length:504 Species:Xenopus tropicalis


Alignment Length:251 Identity:96/251 - (38%)
Similarity:132/251 - (52%) Gaps:22/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NCFCGTPNVNRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRD--- 126
            :|...|...:|||||....:..:||..||:|........||||:|...:|:||||||:|:..   
 Frog   254 SCGLSTKVDSRIVGGTVASAGDWPWQVQLLKRVGASLYLCGGSIITQHWVVTAAHCVYGSTSTPS 318

  Fly   127 -------QITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPV 184
                   .:||      :|....|..  |.:..|||:|.......|||||||.:.:..|.|:|||
 Frog   319 AFKVFAGSLTI------QSYYSAGYT--VERALVHPSYSSYTQNYDVALLKLTAALVFTTNLRPV 375

  Fly   185 CLPEANHNF-DGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTR-YKDKIAEVMLCAGL 247
            |||.....: :|:...::|||....||..|..|:..:||:|::|.|.|.. |...|:..|:|||.
 Frog   376 CLPNVGMPWAEGQPCWISGWGTTSNGGSISTNLKAASVPLISSATCNQAAVYGGAISPTMMCAGY 440

  Fly   248 VQQGGKDACQGDSGGPLIV-NEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302
            : .||.|.|||||||||:. ....:.|.|..|:||||...|.||||..::..|:||
 Frog   441 L-SGGTDTCQGDSGGPLVTKTNSLWWLVGDTSWGYGCGMTNKPGVYGNLTFSLEWI 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 92/239 (38%)
Tryp_SPc 76..305 CDD:238113 93/240 (39%)
tmprss2.14XP_031752402.1 LDLa <96..121 CDD:238060
LDLa 128..159 CDD:238060
SRCR_2 164..259 CDD:406055 1/4 (25%)
Tryp_SPc 265..497 CDD:238113 93/240 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.