DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and tmprss6

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_004913946.2 Gene:tmprss6 / 100489045 XenbaseID:XB-GENE-1011573 Length:806 Species:Xenopus tropicalis


Alignment Length:256 Identity:102/256 - (39%)
Similarity:157/256 - (61%) Gaps:19/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KQNCFCGTPNVN-RIVGGQQVRSNKYPWTAQL-VKGRHYPRLFCGGSLINDRYVLTAAHCV---- 121
            :.||.||...|. |:|||.|.:..::||.|.| |:|.|    .|||:|:.|:::||||||.    
 Frog   557 ENNCGCGIQAVGIRLVGGTQAQEGEWPWQASLQVRGEH----ICGGTLVADQWILTAAHCFTPES 617

  Fly   122 HGNRDQITIRL--LQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTG-NMRP 183
            :.:.:..|:.|  :::.||::.. :..||::..:||.||.:....||||:.|:..||||. :::|
 Frog   618 YASPEVWTVYLGKVRLSRSTQKE-LAFKVIRLVIHPFYDEDSHDYDVALVLLDHLVPLTSPHVQP 681

  Fly   184 VCLPEANHNF-DGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGL 247
            :|||.:.|:| .|.:..|.|||.:||.|.||:.||:|::.::....|.:. |:.:|:..||||| 
 Frog   682 ICLPSSTHHFPTGSSCWVTGWGSVKENGPTSDVLQKVDIQLVAQDICTEL-YRYQISPRMLCAG- 744

  Fly   248 VQQGGKDACQGDSGGPLIVN--EGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNT 306
            .:.|.|||||||||.||:..  .||:..||:||:|.||......|||:|:::.:.||...|
 Frog   745 YRDGSKDACQGDSGSPLVCKTASGRWFQAGLVSWGAGCGIPRYFGVYSRITRLVQWIESIT 805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 94/237 (40%)
Tryp_SPc 76..305 CDD:238113 95/239 (40%)
tmprss6XP_004913946.2 SEA 77..176 CDD:396113
CUB 235..303 CDD:412131
LDLa 448..478 CDD:238060
LDLa 480..514 CDD:238060
LDLa 525..560 CDD:238060 0/2 (0%)
Tryp_SPc 572..804 CDD:238113 95/238 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8078
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.