DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and Gm10334

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001096623.1 Gene:Gm10334 / 100040233 MGIID:3641889 Length:246 Species:Mus musculus


Alignment Length:239 Identity:91/239 - (38%)
Similarity:139/239 - (58%) Gaps:21/239 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 NRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNRDQITIRL----LQ 134
            ::||||...:.|..|:...|..|.|    |||||||||::|::||||.   :.:|.:||    :.
Mouse    22 DKIVGGYTCQENSVPYQVSLNSGYH----FCGGSLINDQWVVSAAHCY---KTRIQVRLGEHNIN 79

  Fly   135 IDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAV 199
            :...:.......|:::   |||::...:.||:.|:||.|||.|...:..|.||.:... .|...:
Mouse    80 VLEGNEQFVNAAKIIK---HPNFNRKTLNNDIMLIKLSSPVTLNARVATVALPSSCAP-AGTQCL 140

  Fly   200 VAGWGLIKEGGVTS-NYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGKDACQGDSGGP 263
            ::|||.....||:. :.||.::.|::..|.| :..|..||...|:|||.: :||||:||||||||
Mouse   141 ISGWGNTLSFGVSEPDLLQCLDAPLLPQADC-EASYPGKITGNMVCAGFL-EGGKDSCQGDSGGP 203

  Fly   264 LIVNEGRYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNTA 307
            ::.|.   :|.|:||:|||||..:.||||.:|..::|||:...|
Mouse   204 VVCNG---ELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 88/231 (38%)
Tryp_SPc 76..305 CDD:238113 90/233 (39%)
Gm10334NP_001096623.1 Tryp_SPc 24..242 CDD:238113 90/233 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.