DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and zgc:163079

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:250 Identity:91/250 - (36%)
Similarity:128/250 - (51%) Gaps:17/250 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QNCFCGTPNVN-RIVGGQQVRSNKYPWTAQL-VKGRHYPRLFCGGSLINDRYVLTAA--HCVHGN 124
            |:..||...:| :|:||.......:||.|.: :|...  ..:|||||||..:|||.|  ..:...
Zfish    23 QSDVCGRAPLNTKIIGGLNATQGSWPWQASINLKATE--EFYCGGSLINKGWVLTTAKVFALMPA 85

  Fly   125 RDQITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEA 189
            .|.:.....|....|....|.|.|.:...||||  |.:.:::|||||.|||..:..::||||..|
Zfish    86 SDIVVYLGRQTQNGSNPYEISRTVTKIIKHPNY--NSLDSNLALLKLSSPVTFSDYIKPVCLAAA 148

  Fly   190 NHNF-DGKTAVVAGWGLIK-----EGGVTSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLV 248
            ...| ||..:.|.|||.:.     |..:..:.||||..|::.|.:| ...|...|...:||||.:
Zfish   149 GSVFVDGTASWVTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFEC-NAAYGGIITNKLLCAGYL 212

  Fly   249 QQGGKDACQGDSGGPLIVNEGRYKL-AGVVSFGYGCAQKNAPGVYARVSKFLDWI 302
            .:.||..|.||.||||::.:|...: :|||..|| |.....|.:|.|||::.|||
Zfish   213 NEDGKAPCAGDVGGPLVIKQGAIWIQSGVVVSGY-CGLPGYPTIYVRVSEYEDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 85/236 (36%)
Tryp_SPc 76..305 CDD:238113 86/236 (36%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 85/236 (36%)
Tryp_SPc 36..267 CDD:238113 86/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587751
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.