DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and LOC100004427

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:250 Identity:90/250 - (36%)
Similarity:131/250 - (52%) Gaps:18/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QNCFCGTPNVN-RIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHG-NRD 126
            |:..||...:| :||||.......:||.|. :..:...:.||.||||::|:|||||.|... |..
Zfish    23 QSDVCGRAPLNTKIVGGLNATEGSWPWQAS-INFKSTGQFFCSGSLISERWVLTAASCFQRINVS 86

  Fly   127 QITIRLLQIDRSSRDP-GIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEAN 190
            .:.|.|.::..:..:| .|.|.|:|.:|         ..|:||::|.|.|..|..:|||||..|.
Zfish    87 DVVIYLGRLTTNGSNPYEIPRTVIQVSV---------TEDIALVQLSSSVTFTDYIRPVCLAAAG 142

  Fly   191 HNF-DGKTAVVAGWGLIKEGGV-TSNYLQEVNVPVITNAQCRQTRYKDKIAEVMLCAGLVQQGGK 253
            ..| ||..:.|.|||......| .|:.|:||..|::.|.:|........:..| :|||.|.:.||
Zfish   143 SVFVDGTESWVTGWGSTSSTNVILSDMLKEVEAPIVNNIECSNINGITNLDNV-ICAGFVNETGK 206

  Fly   254 DACQGDSGGPLIVNEG-RYKLAGVVSFGYGCAQKNAPGVYARVSKFLDWIRKNTA 307
            ..|..|.|.||:..:| ::..:|||.|.: |.|...|.:|||||::.:|||..|:
Zfish   207 APCWEDFGSPLVTRQGSQWIQSGVVVFTF-CGQNGFPTLYARVSEYEEWIRNYTS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 82/231 (35%)
Tryp_SPc 76..305 CDD:238113 85/233 (36%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 82/231 (35%)
Tryp_SPc 36..257 CDD:238113 84/232 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587757
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 201 1.000 Inparanoid score I3731
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.