DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3355 and si:dkey-16l2.17

DIOPT Version :9

Sequence 1:NP_608848.1 Gene:CG3355 / 33667 FlyBaseID:FBgn0031619 Length:314 Species:Drosophila melanogaster
Sequence 2:XP_001341498.1 Gene:si:dkey-16l2.17 / 100001520 ZFINID:ZDB-GENE-141212-262 Length:305 Species:Danio rerio


Alignment Length:283 Identity:109/283 - (38%)
Similarity:148/283 - (52%) Gaps:42/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 CTAKQNCFCGTPNV-NRIVGGQQVRSNKYPWTAQLVKGR--HYPRLFCGGSLINDRYVLTAAHCV 121
            |.|:   .||.|.: .|||||.:.....:||...:..|.  |    .||||:|...:||:|||| 
Zfish    18 CLAQ---VCGRPPLGKRIVGGVEASPGSWPWQVDIQMGSNGH----VCGGSIIAKNWVLSAAHC- 74

  Fly   122 HGNRDQITIRLLQIDR-------SSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTG 179
            ..|..:::...|.:.|       .......|::||   :...|...:...||||::|.:||..|.
Zfish    75 FPNPSEVSAYTLYMGRHLLNGYNQFEKVSYVQRVV---IPEGYTDPQGGRDVALVQLRAPVSWTD 136

  Fly   180 NMRPVCLPEANHNFD-GKTAVVAGWGLIKEG----GVTSNYLQEVNVPVITNAQCR---QTRYKD 236
            .::|||||.|:..|: |....|.|||..:||    |..:  |:||.||:|..:.|:   |....|
Zfish   137 RIQPVCLPFADFQFNSGTLCYVTGWGHKQEGVSLTGAAA--LREVEVPIIDQSSCQFMYQILSSD 199

  Fly   237 K----IAEVMLCAGLVQQGGKDACQGDSGGPLI--VNEGRYKLAGVVSFGYGCAQKNAPGVYARV 295
            .    |...|:||| .::||||:|||||||||:  |..|.:..|||||||.||||||.||:|:||
Zfish   200 SSTVDILSDMICAG-YKEGGKDSCQGDSGGPLVCPVGNGTWIQAGVVSFGLGCAQKNRPGIYSRV 263

  Fly   296 SKFLDWIRKNTAD----GCYCQS 314
            |.|...||....:    |..|:|
Zfish   264 SSFEKLIRTTVPEAYFLGHACRS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3355NP_608848.1 Tryp_SPc 75..302 CDD:214473 99/249 (40%)
Tryp_SPc 76..305 CDD:238113 100/251 (40%)
si:dkey-16l2.17XP_001341498.1 Tryp_SPc 32..273 CDD:238113 100/251 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587823
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.