powered by:
Protein Alignment HP6 and CBX4
DIOPT Version :9
Sequence 1: | NP_608842.1 |
Gene: | HP6 / 33661 |
FlyBaseID: | FBgn0031613 |
Length: | 106 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_003646.2 |
Gene: | CBX4 / 8535 |
HGNCID: | 1554 |
Length: | 560 |
Species: | Homo sapiens |
Alignment Length: | 66 |
Identity: | 16/66 - (24%) |
Similarity: | 30/66 - (45%) |
Gaps: | 15/66 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 GKLTFLMQWKGCDEA--GLVPAEVLNVRCPQMVISFYEERIVFTDEGDEEDLESDNGY-ETTPSP 98
|::.:|::|:|.... ...|.| |:..|:::|:|. :.|..|...|| :..|.|
Human 24 GRVEYLVKWRGWSPKYNTWEPEE--NILDPRLLIAFQ----------NRERQEQLMGYRKRGPKP 76
Fly 99 R 99
:
Human 77 K 77
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1628171at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.