DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and TFL2

DIOPT Version :10

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001330016.1 Gene:TFL2 / 831635 AraportID:AT5G17690 Length:452 Species:Arabidopsis thaliana


Alignment Length:38 Identity:13/38 - (34%)
Similarity:16/38 - (42%) Gaps:12/38 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 DEGDEEDLES------------DNGYETTPSPRKKRSR 104
            |.|||||.|.            |.|:....:.|:||.|
plant    82 DGGDEEDEEGEGEGGQEERPKLDEGFYEIEAIRRKRVR 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 CSD 24..75 CDD:349275
TFL2NP_001330016.1 CD_CSD 108..163 CDD:349274 4/12 (33%)
CSD 397..446 CDD:349338
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.