DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and cbx8

DIOPT Version :10

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001072443.1 Gene:cbx8 / 779897 XenbaseID:XB-GENE-977527 Length:362 Species:Xenopus tropicalis


Alignment Length:66 Identity:15/66 - (22%)
Similarity:32/66 - (48%) Gaps:15/66 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GKLTFLMQWKGCDE--AGLVPAE-VLNVRCPQMVISFYEERIVFTDEGDEEDLESDNGYETTPSP 98
            |::.:|::|||..:  :...|.| :|:.|    :::.:|:|        |.:.|.....:..|.|
 Frog    24 GRMEYLVKWKGWSQKYSTWEPEENILDAR----LVAAFEDR--------EREREMYGPKKRGPKP 76

  Fly    99 R 99
            :
 Frog    77 K 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 CSD 24..75 CDD:349275 10/40 (25%)
cbx8NP_001072443.1 CD_Cbx6 8..65 CDD:349295 12/52 (23%)
CBX7_C <332..354 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.