DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP6 and Mphosph8

DIOPT Version :10

Sequence 1:NP_608842.1 Gene:HP6 / 33661 FlyBaseID:FBgn0031613 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001347001.1 Gene:Mphosph8 / 75339 MGIID:1922589 Length:870 Species:Mus musculus


Alignment Length:113 Identity:28/113 - (24%)
Similarity:49/113 - (43%) Gaps:18/113 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 STALPVKQRNGFDLGLEPLRILGACNWSGKLTFLMQWKG-CDEAGLVPAEVLNVRCPQMVISFYE 72
            :.|:...:.:|.|: .|..|||......||..:.::||| ..|......||....|.::::.|.:
Mouse    45 TVAVGDSEEDGEDV-FEVERILDMKCEGGKNLYKVRWKGYTSEDDTWEPEVHLEDCKEVLLEFRK 108

  Fly    73 --------------ERIVFTDEGDEEDLESDNGYETTP--SPRKKRSR 104
                          :|:...::..|.|.:||...:|..  |||||:.:
Mouse   109 KLAENKAKAVRKDIQRLSLNNDIFEADSDSDQQSDTKEDISPRKKKKK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP6NP_608842.1 CSD 24..75 CDD:349275 14/65 (22%)
Mphosph8NP_001347001.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..55 1/9 (11%)
CD_MMP8 58..108 CDD:349283 14/50 (28%)
Histone H3K9me3 binding. /evidence=ECO:0000250|UniProtKB:Q99549 80..87 3/6 (50%)
PTZ00121 <97..482 CDD:173412 13/60 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..175 10/28 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..234
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..300
ANKYR <553..734 CDD:440430
ANK 1 610..639
ANK repeat 613..641 CDD:293786
ANK repeat 643..674 CDD:293786
ANK 2 643..672
ANK repeat 676..705 CDD:293786
ANK 3 676..705
ANK 4 709..738
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.