DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HP6 and Mphosph8

DIOPT Version :9

Sequence 1:	NP_608842.1	Gene:	HP6 / 33661	FlyBaseID:	FBgn0031613	Length:	106	Species:	Drosophila melanogaster
Sequence 2:	NP_001347001.1	Gene:	Mphosph8 / 75339	MGIID:	1922589	Length:	870	Species:	Mus musculus

Alignment Length:	113	Identity:	28/113 - (24%)
Similarity:	49/113 - (43%)	Gaps:	18/113 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 STALPVKQRNGFDLGLEPLRILGACNWSGKLTFLMQWKG-CDEAGLVPAEVLNVRCPQMVISFYE 72
            :.|:...:.:|.|: .|..|||......||..:.::||| ..|......||....|.::::.|.:
Mouse    45 TVAVGDSEEDGEDV-FEVERILDMKCEGGKNLYKVRWKGYTSEDDTWEPEVHLEDCKEVLLEFRK 108

  Fly    73 --------------ERIVFTDEGDEEDLESDNGYETTP--SPRKKRSR 104
                          :|:...::..|.|.:||...:|..  |||||:.:
Mouse   109 KLAENKAKAVRKDIQRLSLNNDIFEADSDSDQQSDTKEDISPRKKKKK 156

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HP6	NP_608842.1	Chromo_shadow	25..76	CDD:279701	15/65 (23%)
Mphosph8	NP_001347001.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	18..55		1/9 (11%)
		CHROMO	58..109	CDD:214605	14/51 (27%)
		Histone H3K9me3 binding. /evidence=ECO:0000250\|UniProtKB:Q99549	80..87		3/6 (50%)
		Neuromodulin_N	<97..482	CDD:331332	13/60 (22%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	129..175		10/28 (36%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	209..234
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	250..300
		ANK	605..729	CDD:238125
		ANK 1	610..639
		ANK repeat	613..641	CDD:293786
		ANK repeat	643..674	CDD:293786
		ANK 2	643..672
		ANK repeat	676..705	CDD:293786
		ANK 3	676..705
		ANK 4	709..738
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1911
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1628171at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.820